DPCstruct | MC676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519CSZ0 | 1-86 | MKYRYNEGEILKELTEYINKTYGEHYATEGFQIQDVFNHLQIAEPFCRANAIKYLYRFGDKEGKNKKDLLKALHYSILLYHFSGMD |
| A0A2E5AWE7 | 20-105 | FPIKTEFKYNEDEILDSIKEYVGKTYSKHYSNKIQTLDLIDSVGDASAFCRSNILKYASRYDKKGTPKLDIQKIIHYAVLLYHFEG |
| A0A2D4TRM0 | 26-116 | None |
| A0A2D7C068 | 1-86 | None |
| A0A2E9UI69 | 21-123 | None |
| A0A2E2V017 | 7-99 | None |
| A0A2E9JI11 | 17-131 | None |
| A0A2E9FIY5 | 218-301 | None |
| A0A2E1UXZ5 | 2-89 | None |
| A0A382JZ70 | 108-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.