DPCstruct | MC6756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 238 ± 53 aa |
| Standard deviation of domain lengths | 53.23 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 70.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067Q3J9 | 1-189 | MALLSWHPIITYASIPNVLVLQTAVATHEEALVDTVCSRAQTQFVDRQYKQVVKKLDYLMWHSSHRNQEYSGLSSARAGEAQLLDGP… |
| A0A550BST1 | 537-810 | FVDILKQQYLGPQWMKDMATEFQLQSFREPKHKNESPSDFIYHRILHARSLAFAIPDTPEEIKLVLSVAPADWDAKIMPTTLQSTDQ… |
| A0A0C9XV84 | 594-792 | None |
| A0A0C9WHU9 | 570-793 | None |
| A0A4Y9Y2F3 | 306-491 | None |
| A0A166MKQ1 | 680-1002 | None |
| D8Q8E8 | 577-771 | None |
| A0A166MXF6 | 1-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.