DPCstruct | MC6751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 268 ± 42 aa |
| Standard deviation of domain lengths | 42.10 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7TTN3 | 426-649 | GKGKQKEKGDDAKGRVRFDEWGTEDQEKAIEDGRKDCNKFIESRDESDVSFSTRRLIREQQPVLPEAVTSDPDLALLLFKTSSNNTI… |
| A0A067S4W8 | 49-251 | LTVAEVEELEAIGQLQLKRFNDTGVVHNIQPDIRQFCIEFAEFLPESGYTSKEMALAMHWKPPGYYTCRFHKSPMPDKPTFFDGNGT… |
| K5XDT0 | 342-626 | None |
| A0A0D0CMM0 | 535-801 | None |
| A0A0D0BR86 | 374-648 | None |
| A0A409W863 | 669-886 | None |
| E2LXU0 | 242-528 | None |
| A0A0D2QD21 | 791-1045 | None |
| A0A0C3EGM3 | 61-306 | None |
| F8PMS9 | 204-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.