DPCstruct | MC6750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 161 ± 30 aa |
| Standard deviation of domain lengths | 29.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S8FNC4 | 4-159 | EEVVFTVVMEHTPDIPSSDPSDPFLESTAYFSLVLQVSIQDDPRLKYRLRESPLAVLERWHGPQDSHLAPDWCHTMDAGDRHSFRQP… |
| A0A067S4M0 | 20-186 | IDTWISQAKTQTKAPTANPHKRSQCLEYLSWQDDVECILNVVRREGLVEGDDPSEFTLTLRVRVPPTAGFLMYYWQSPTVVIDEYKR… |
| A0A4V2K883 | 24-223 | None |
| A0A2G8RW14 | 31-190 | None |
| S7QHD6 | 65-244 | None |
| A0A5C2SHN8 | 16-204 | None |
| A0A137QVT2 | 14-123 | None |
| A0A0C3B8S0 | 8-150 | None |
| A0A4Y9Y6B3 | 3-188 | None |
| A0A1Y2I8Q6 | 51-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.