DPCstruct | MC675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 249 ± 30 aa |
| Standard deviation of domain lengths | 30.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6U4FMT1 | 1-259 | VGGSGEIPPRQALEVFRRLLAKLDGIARALVRGAGGRELSLEALSTHETGAELREVLAGLRSLVAQVPAASRDEVALRLGQQLFKRM… |
| A0A453JA88 | 1-252 | MSNDLPAGGIMDLNVMTPPPATFPDNLGSGLPDTLSTGDAMERYEQVSQKLEVLIAKDGKDVEIQSVVAEVPDILLKCVNRDEAALA… |
| A0A2P2MSE1 | 252-509 | None |
| F6GV61 | 9-199 | None |
| A0A1D6PMI2 | 623-873 | None |
| A0A1D6PMF5 | 283-532 | None |
| A0A287Q226 | 2-203 | None |
| A0A452YUI5 | 229-484 | None |
| A0A452YUD7 | 266-525 | None |
| A0A452YUD2 | 1-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.