DPCstruct | MC6749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 65.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8F2Y0 | 194-299 | KSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLIPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPW… |
| A0A067S478 | 1-99 | MIVGNTKLASWLVLPFLVGLSRIKCLLLTERAFKESGIEFFDTYDKLIPCYDIEPVEKIPDAYLDQFLFFEADKCGLFPIWIKPAIG… |
| A0A821K7U3 | 25-116 | None |
| A0A4S8M920 | 412-499 | None |
| A0A086M4B6 | 485-589 | None |
| A0A818FDH3 | 42-116 | None |
| A0A2H1CAH6 | 845-953 | None |
| A0A4Y1R837 | 53-158 | None |
| A0A314ZAI9 | 515-606 | None |
| C6H9U1 | 744-836 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.