DPCstruct | MC6746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 236 ± 43 aa |
| Standard deviation of domain lengths | 43.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6DUS9 | 1-178 | MDRSATIRKPFDRIAYFLELQPKQGRAEFVYVSVKAFTSDLKKIGVPTAASGARFQQNVEEMNVFSDVKRVVTGTGLTGGNIEFWSS… |
| A0A3D1K8S2 | 195-440 | PPPPPPPKPVEEVKAEPAKEEPKKEEAKKDEPPSKEEASSEDSMLKFVPDAKGNQVIYYLDLVKSGDTIKYDVDNHKTFKKPFDRIA… |
| A0A2V2GJ90 | 645-962 | None |
| A0A7X6YGY7 | 329-561 | None |
| A0A7X6YD96 | 13-224 | None |
| A0A7S2A1T1 | 71-295 | None |
| A0A7V6HH34 | 333-575 | None |
| A0A5C5Z3C7 | 407-657 | None |
| A0A1J5TL07 | 280-503 | None |
| A0A3M0I8S3 | 158-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.