DPCstruct | MC6745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 35.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094WKQ0 | 135-210 | AELANEEEVAFIDLTKLSSEAYQRLGIEASKKWFMWLKPGESPNYPEGNEDNTHFSETGARAIAGIVISELQKQNL |
| A0A354UBB1 | 1-84 | MRRTAEETDVPLIDLNAMTTDWLNRIGAEVSAEYFMHVSPGVYPDWKEGAADDTHFREKGARLIAGMIAEDAKRRRLPLAECFR |
| A0A1J0SS48 | 2-71 | None |
| A0A427YKR0 | 604-679 | None |
| R9I5N2 | 53-135 | None |
| A0A1F3NCA2 | 44-125 | None |
| A0A5C4TAQ2 | 44-126 | None |
| A0A235BDC5 | 158-237 | None |
| K1TM37 | 100-182 | None |
| A0A7X8V898 | 502-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.