DPCstruct | MC6744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 222 ± 70 aa |
| Standard deviation of domain lengths | 69.99 |
| Length coefficient of variation | 0.32 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4L5M8 | 7-273 | RRVGAARPSHLMYTAGVGSLIDLPNFSVLVKGLESWSHGGLTDSVIDEPRLRTAVNRSLQLYGAARVEELRSAPWMEGADSSPKDWA… |
| A0A0E2BM86 | 15-328 | NQIRQSQLITPFGTGALTDILNQSVMVAGSEFWNSRAVEDNKFYDVRLQRAMKAEGFVAPPTSEGFIAVKTFPTWYSSPSSSILKQL… |
| A0A4Q3EIF0 | 1-114 | None |
| A0A517XM58 | 12-116 | None |
| A0A365VRT6 | 1-155 | None |
| A0A7Y2SSC8 | 2-212 | None |
| A0A831ZQQ9 | 14-334 | None |
| F9UHU9 | 1-154 | None |
| A0A6F8YKR0 | 32-183 | None |
| A0A844CUT3 | 1-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.