DPCstruct | MC6743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6SZU9 | 28-138 | ESMMGSTAMTYDLSEEKLMKLKYKSQHGDSEASFRLYQYYCFTKNNIYKQLQYLERSASQGNVTAQFNYGVFLSDTNPILSEYYNLN… |
| A0A5J6PWR0 | 1-104 | MANPISSGSIYMLSEEEIRVLEEKANYGDADAAFRLYQYHMFVSLNQELEYKWLVIAAKHGHAVAQSNLADLFLEDNDKEQATFWAK… |
| A0A0F2DB42 | 49-137 | None |
| A0A4R7FF15 | 38-141 | None |
| A0A0C1GGL2 | 25-133 | None |
| A0A104J9H0 | 59-161 | None |
| A0A2X2J457 | 1-82 | None |
| A0A6I3T1J7 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.