DPCstruct | MC674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 110 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3KU22 | 3-99 | QPPEDYAADSLDRASPSRNASSKYDFVKVKVWLGENADHYYVLSRFLLCRMLTITKIPNHVAIKIALELKKLLVDNSLLDVSHSDLE… |
| A0A1E1J6U6 | 2-95 | SSKYDVVKLKVHLSDVHYYVLSRFLLSKMLMFCCVPEDTAVRISLDVKKHFVNTERTSITQAELEDYIRCSMIAAGFAQEHARLFSV… |
| A0A5N5NCK8 | 2-142 | None |
| A0A1D2A4P6 | 2-102 | None |
| A0A3R7W1S9 | 327-427 | None |
| A0A5J4WSE4 | 2-86 | None |
| A0A2I0I5H1 | 30-169 | None |
| A0A811MK22 | 1-120 | None |
| A0A6S7M688 | 2-129 | None |
| A0A7J6F5B4 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.