DPCstruct | MC6739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 196 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4L8S1 | 3-217 | TVKIRPVVEPTALYCRYENNYEPQPVYINLDLADGALYADYRATNDTPMRVWLGQVRAWKIPPLVADAANELLKDIAPLAQRILDGS… |
| A0A7X6I7P4 | 122-316 | QIVYRLDDIRDYQAPLYETVAHEVTPAYAHVELDEEGFVSTNTRHRTSGTPVEAWNGRTIEWEVEPSVDGDELADFLESEECEKLLQ… |
| A0A1V6K7J1 | 5-203 | None |
| A0A0J6V5W2 | 29-207 | None |
| A0A4Z0HCH5 | 4-205 | None |
| A0A1I6BMI7 | 1-212 | None |
| D0LEE3 | 16-207 | None |
| A0A6H1ZF68 | 1-196 | None |
| A0A084T5T2 | 83-269 | None |
| A0A4Y9RF54 | 4-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.