DPCstruct | MC6738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 190 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848WN33 | 31-205 | KEIVLDEAYRNISVRDGNQNVSMPMAQAIMRSLAVNAAKGQHRAQRLFAEMLSATERQNKQLADEWLSTAMDYKIEWDKELARRATL… |
| A0A1N6DAB3 | 52-217 | TQMIVSHGDKKLPVPVGGDIQKISAIEAALNKLFKMGMEGHSPSLRLYLEIQAEAQRSLHAANDEFTMAAIIWRNRYLEQFLESDRL… |
| A0A1W6CUD0 | 35-244 | None |
| A0A5B9Z0Y7 | 16-204 | None |
| A0A258VDU1 | 2-195 | None |
| A0A4Q3DQA0 | 2-190 | None |
| A0A2P8N806 | 1-199 | None |
| A0A1C7D6X9 | 1-179 | None |
| A0A257HAD3 | 69-294 | None |
| A0A4V5PUU4 | 27-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.