DPCstruct | MC6737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5LF29 | 1-104 | MTIYEQIKEYCKGKMNQIIEVHEIKRQLKCKYGTNPDSVILSDYCYNRYNKGIVFDKHLFQYINRNSYKYIGENYPYTGLIFHKPKG… |
| D4FX31 | 1-89 | MTIYEQIKDALKNKINELVRPQEVKKTLQEKYGTNPDSIILSDYCYNRYNKGISFNKHLFEYVNRSSYKYLGENSLYTGLIFRKIKR… |
| R6PAE3 | 262-343 | None |
| A0A1Q6U0N1 | 2-77 | None |
| A0A6G3M3B4 | 1-74 | None |
| A0A1M4XAK3 | 1-95 | None |
| R5SFS9 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.