DPCstruct | MC6732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 55 ± 6 aa |
| Standard deviation of domain lengths | 6.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 40.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9MFM8 | 1-53 | MIYQAFQPLPRFGDSYTLIGSWIIDDEASGMGIREDNTLITKDTSRFVPHYIA |
| A0A3T1DYL6 | 10-62 | WIRQAYHPMPRFGNNHALIGSWVVGDRACGMGIREDVGRITKDSSCFVPHAIV |
| A0A379AB21 | 2-65 | None |
| A0A4Q3XXZ2 | 56-105 | None |
| A0A645HJ97 | 86-133 | None |
| A0A7G2JWK4 | 23-80 | None |
| A0A149S3M4 | 3-69 | None |
| A0A379VKE0 | 1-51 | None |
| A0A3R0CHF8 | 111-161 | None |
| A0A0J6T3W0 | 10-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.