DPCstruct | MC6731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DXU0 | 1-85 | MNPLSVTDAVPNDLDNALLVGRVWLDGPHAGPALVSVHDGQVIDITDLGPTMADLLERDDLLEVVKRAEGKPLGSLETLLANSQA |
| A0A358GTR8 | 1-98 | MNFTLNSQNSLPNDTTQGCLIGRAWIPDQISGPSPIILKDDQVFDISEKFHTISQLLESSDPLKALSEIEGKLVGSIDELFANTVAE… |
| A0A2V6RZW6 | 6-105 | None |
| M9RCJ3 | 2-90 | None |
| A0A3B0T2J8 | 273-363 | None |
| A0A7W2UJJ1 | 1-118 | None |
| A0A6J5FSJ8 | 1-93 | None |
| A0A4Q4XB17 | 5-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.