DPCstruct | MC673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3GB96 | 91-164 | NDAAFYARTELPSSMPNLERLLIHSDTEMVNTQMLPSKFYHLKYLNIALGGGTYDYLSLVSFFDTSPFLETFNL |
| A0A453J5R0 | 1-91 | MEMRCSTQCNTIYNACANLPSIVPNIETLSISSVSEVVNIPIVPVKFLHLKYLSISLEGNGAFSPDYDYFSLVSLLDACPVLETFNL… |
| A0A0E0PRR2 | 200-273 | None |
| A0A2S3I0C9 | 342-442 | None |
| M7Z5L6 | 264-360 | None |
| A0A0E0M383 | 4-93 | None |
| Q7XM85 | 711-802 | None |
| A0A0E0QM60 | 47-145 | None |
| R7WCZ4 | 606-703 | None |
| Q10PX9 | 55-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.