DPCstruct | MC6729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 179 ± 28 aa |
| Standard deviation of domain lengths | 27.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF11874- CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655RG11 | 2-132 | VYPAQVMYAGTKLEQIVEQAPVGQPIQMIVAGENLKGEYTSKTVQLPFEDRAVSAQERIASMGLTLLNDKNRMLVEMVEFGSPAEAA… |
| A0A3T1DWF9 | 12-190 | VFIVATTAMLIFAAGTQGYMIARNRWYESLLLLLVAFTLFRPGFWMDRIHDPYESIPPTQFAEALGSVDDGSNLRVQIAGVDDYGDP… |
| A0A7C3VKV4 | 397-589 | None |
| A0A1E7HE24 | 2-181 | None |
| A0A7Z9VF79 | 100-302 | None |
| A0A381XYE7 | 89-281 | None |
| A0A090P795 | 2-152 | None |
| A0A4R1YZ86 | 211-408 | None |
| A0A661PAB8 | 302-494 | None |
| A0A0F3NEK6 | 4-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.