DPCstruct | MC6727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 174 ± 33 aa |
| Standard deviation of domain lengths | 32.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DV92 | 1-176 | MRGVFDENNTSPFWESLGKHFFPMDFSEADRLTGLGQKSFIGELMPKFPIYTTFMAEEARSCIGQVHRHTRPALEMLKKEGLRWEGY… |
| A0A090TCS9 | 1-117 | MPKLPIYINLLSKEAQAVIGQVHENTRPALKLLEKEGFTCRNYVDIFDAGPTVECDLRNIQAVRDSFRAKVSVAEHTSSQDYLIANT… |
| J2VHG0 | 1-139 | None |
| A0A1B7XI83 | 134-324 | None |
| A0A328RBH4 | 123-349 | None |
| A0A6N6XKV7 | 1-156 | None |
| A0A1W7MAV1 | 80-270 | None |
| A0A5I3FD05 | 121-262 | None |
| A0A485D5X1 | 51-192 | None |
| A0A2A4Z2H3 | 161-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.