DPCstruct | MC6725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 128 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DUX6 | 1-139 | MTISVAEVDPVLVTTRREALEEPYRTMIGHMRHEISHMLWWRLSLRDDFLDAFREMFGDERQDYQAALQRHYQDGPPPDWKERYLTT… |
| M2AYV9 | 50-177 | TGHQNGLITINLAEADSVHRERLRVKLGEPQRTLIGHMRHEVGHYIDWAWASRVAPAKYHALFGDPNTLDYGEAMKKHYAVGAPANW… |
| A0A2P8KF45 | 196-331 | None |
| A0A6P3ZBP0 | 131-267 | None |
| A0A4Q2XTL8 | 83-207 | None |
| A0A7Y2HU99 | 3-115 | None |
| A0A6N2DGU2 | 278-408 | None |
| A0A5B8V5F4 | 5-131 | None |
| A0A494XUJ4 | 108-233 | None |
| A0A0S8EYM3 | 162-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.