DPCstruct | MC6724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.73 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0063- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DUU9 | 1-103 | MNQPVDVSQRLPDANGLFGSFGGRFVAETLMPLILELQDEYATAKNDPEFQRQLAYFQGDYVGRPSPLYFAERLTEHFCGASIYLKR… |
| A0A431I7Y8 | 185-275 | YYGAYGGMYVPELLIDPLHDLIDAFKTIVPSQEFQSEFLGLLKNYVGRPTALTKVSNFAKAIGLQHVYLKREDLTHTGAHKINNALG… |
| A0A1U7WTW8 | 49-163 | None |
| H1LI88 | 6-103 | None |
| F4PSW7 | 2-106 | None |
| A0A1S8VFD5 | 284-371 | None |
| F3KFG2 | 3-87 | None |
| A0A024GLV5 | 293-384 | None |
| A0A4S4LWZ3 | 291-404 | None |
| A0A2B4RK45 | 466-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.