DPCstruct | MC6723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 121 ± 27 aa |
| Standard deviation of domain lengths | 27.15 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5LAL5 | 671-799 | TDNVLSVSTGGGNIFAKYMKEAVSFVKQFDYNGNLIREIALPGKGTASGFGGKEKDKEIYYSFTNYITPSTTYKINVETGKSEIYLK… |
| A0A3T1DTR2 | 17-115 | LLFDAQHSCTLDEYLALPEQPCSQMLEDAPHFDTQVLRLREESFTQPPSWFALDLTNGERTLLKRAPVYGNLQPEQLISRRLWATSS… |
| A0A1X7SGK8 | 89-172 | None |
| A0A3P6R8A6 | 120-245 | None |
| A0A3L6VSZ7 | 1-77 | None |
| R7W5N6 | 348-464 | None |
| A0A368G440 | 23-130 | None |
| A0A7V9L627 | 166-328 | None |
| A0A7S0Y9S1 | 170-255 | None |
| A0A7M5V7V9 | 2-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.