DPCstruct | MC6720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VJ43 | 1-82 | HPDVHFTLGISNISFGLNPAARQVLNSVFLHECVQAGLDTAIVHASKILPIARIPEEHREVALDLVYDRRREGYDPLQKLME |
| A0A3T1DRJ9 | 2-86 | ISGGVSNVSFSFRGNNPVREAIHSAFLYHAIRAGLTMGIVNAGQLAVYDDLPAELREAVEDVVLNRRSDGTERLLDIADKYKGDG |
| A0A377B6T9 | 72-156 | None |
| A0A7S0AFA1 | 396-523 | None |
| A0A3L7WJM2 | 327-415 | None |
| A0A376VPX5 | 264-348 | None |
| A0A821ANB3 | 8-99 | None |
| A0A5S9M8Z2 | 121-222 | None |
| A0A3S4FMF1 | 14-92 | None |
| A0A7S1F2H9 | 275-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.