DPCstruct | MC672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453CM95 | 16-104 | VWIYAFLPGFDKLYTVGLAAICWAIWLARNSATFERKWINTPFEVVFTSCAFLNYWAGLQKPAMMEVVKKGAEMLKENASQMLLLCG… |
| A0A453J1M2 | 2-82 | FLPDGERFYTFGLAAICWAIWNCRNQATFEQKKLKTPFAVSFLACGFMSYWAGMMNGEDREMMERGSKMLKASASAMMRIC |
| A0A811N0H6 | 320-400 | None |
| A0A3L6G9D0 | 2-100 | None |
| A0A835F9L3 | 38-120 | None |
| A0A453C6V3 | 27-119 | None |
| B9FLZ0 | 2-78 | None |
| Q7XMS7 | 208-286 | None |
| A0A2K2DLQ6 | 83-166 | None |
| A0A811QR49 | 627-706 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.