DPCstruct | MC6717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 94 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DM45 | 1-94 | MEQKHLPEDDLEFIQDVAPLMQKPNYLRVNGKPLLIVYRVDILPDANKTAEVWRNYCRENGIGEIHLVSAQSFNNGDPSPFGFDASV… |
| A0A4Q0UAE7 | 140-234 | IQQTYPGEEDDRKHFMSLLPAFKDRRYIKVDGKPLFVIYHPLDAPDAIRAKIKLWRSLASRHGLGDFHFVGISYFPDSEKAAMLDLG… |
| A0A2V7W5C7 | 784-877 | None |
| A0A5C8DWE9 | 32-122 | None |
| A0A816URM9 | 39-140 | None |
| A0A1Q3Y9Z7 | 125-215 | None |
| A0A1Q6SZH4 | 263-354 | None |
| A0A4T0VD24 | 63-159 | None |
| A0A650ELQ9 | 136-226 | None |
| A0A812RTB3 | 533-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.