DPCstruct | MC6716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 12.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DLZ4 | 3-138 | IEARDFYRNGPDHRQGQTSSFALIRRQFDFRSIEIGRWVTNAERDRAAELFHDALCDLMLILQGPEALISLRGSIALQYGSGGRPGV… |
| A0A6J4RCD8 | 383-513 | VNVETARDVESVADALRLRTGLGRIAFDRGMPAAWRVPALRDLESAIADLRLALPAFTLDGLAVRIGSSPKGDLALALHEPSTRTIF… |
| A0A513RQF2 | 255-396 | None |
| A0A839A2J2 | 321-448 | None |
| A0A7I0BF38 | 746-884 | None |
| R9ISL5 | 248-362 | None |
| A0A3E0DVS1 | 1-123 | None |
| A0A843GDF7 | 346-467 | None |
| A0A7U9PPQ9 | 266-387 | None |
| A0A2N0AZ65 | 359-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.