DPCstruct | MC6715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 92 ± 5 aa |
| Standard deviation of domain lengths | 4.82 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832A767 | 40-132 | LLLTALACLVLGMEVPTTAAYVICVSVAGPALQQLGLAPLQAHLFVFWFALLSTITPPVCGAVFIAAGMVGENWLKVALTAMALGIG… |
| A0A1F4HGV2 | 1-86 | MGMPTPSVYILAAVLVAPALTQLGVSLMAAHLFLVYYASLSAMTPPIAVAAFAAAPIALAHPMAIGLNAVRMAMIAFVVPFAFVYN |
| A0A2D4VYC4 | 1-79 | None |
| A0A381XYE7 | 1-97 | None |
| A0A0F9T5U1 | 3-95 | None |
| A0A379GJ45 | 14-102 | None |
| A0A7D7ZLM9 | 113-206 | None |
| A0A645HWM6 | 2-92 | None |
| A0A455U864 | 3-94 | None |
| A0A812M3M1 | 438-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.