DPCstruct | MC6714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 18.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A508ZMX0 | 213-333 | MKPRHADLFASDLDEATLIRSIDRLLMFYIRTADRLQRTSTWMDNLEGGVAYLRQVVLEDSLGIGEELEQEMARIVDSYQCEWQTTL… |
| A0A3T1DKH5 | 23-127 | QLYRTIDRFLMFYVRTADRLQRTSVWRENLDGGLEYLKEVILEDSLGINDELERQMQSVVDTYQCEWADAISDPEKLKRFRSFVNDD… |
| A0A485BSJ7 | 162-293 | None |
| A0A447LQ69 | 20-140 | None |
| A0A1E7Z1M2 | 13-119 | None |
| A0A3M5YIY5 | 969-1088 | None |
| A0A4V6YXU7 | 289-431 | None |
| A0A561UUG3 | 8-139 | None |
| A0A0B8NWL3 | 1-87 | None |
| A0A7Y4J9A6 | 13-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.