DPCstruct | MC6713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645J791 | 93-158 | VAVVTAILTEEQRRKKAGDLRPIPMRPDHGHQMLDDLHKKTNPGYSAIGRLKGLAEVRGVELALKM |
| A0A3T1DKD6 | 6-64 | DVILDIEEKRGEQLPFRPDHGHAMLSDLRSGFKPGYPAIGRLRGMAEIRGVERALRFKR |
| A0A377ZCX4 | 3-65 | None |
| A0A7X6EMP7 | 2-56 | None |
| A0A426H6Y9 | 1-60 | None |
| A0A7S2NF06 | 34-102 | None |
| A0A257F215 | 115-182 | None |
| A0A7C7V450 | 6-56 | None |
| A0A3B0MTV2 | 139-200 | None |
| A0A411YYI0 | 42-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.