DPCstruct | MC6712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DJF3 | 3-58 | RRARQRGLTEIFVLTTHTAHWFVEHGFRAASLEDLPPLKRETYNHARKSKVLVKQL |
| A0A7S2B222 | 55-112 | ERVAVTSGIHNVFVLSTQTMQWFQERGFNEVDLESLPESRQAIYNHRRGSKVYMKHLR |
| A0A444E4P9 | 21-90 | None |
| A0A7Y0X6B0 | 8-65 | None |
| A0A1Q9D3W4 | 1183-1240 | None |
| A0A453RIE9 | 5-62 | None |
| A0A7J8Y8P9 | 44-117 | None |
| A0A804QFV6 | 336-392 | None |
| A0A1Q3BJH8 | 947-1004 | None |
| A0A0G4FV52 | 76-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.