DPCstruct | MC6709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8FF89 | 86-166 | MGMNAHNDYADRKNNRQAVKPIHPELEEPLREILSETYGLIVYQEQIMFIAQKVASYTMGKADALRKAMGKKKLEVLEAEY |
| A0A3T1DI19 | 1-70 | MVDDFINRKHGRAEVSYPHPDYQHELLKPVLAPTYGIILYQEQVMQIAQVMAGYSLGQADMLRRAMGKKK |
| A0A2I8CYM0 | 295-374 | None |
| M7A2V5 | 15-93 | None |
| A0A2C6M9R9 | 32-107 | None |
| A0A7C7RQG5 | 145-240 | None |
| R5FW09 | 184-281 | None |
| W7C9X8 | 98-192 | None |
| A0A800BPQ7 | 2-78 | None |
| A0A376TKK6 | 135-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.