DPCstruct | MC6706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 72 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832CTH7 | 17-85 | LVNSQKKLPKPIIIILGLIISLAIVAGAIYLWQKYPQDKFCTMEAKICPDGSSVGRIPPDCEFAPCPSV |
| A0A2H0TE80 | 20-87 | TSPLTRRLLFIVAGVLLVAGLAFAGYSIWKGGSGEDDIVFCTQDAMLCPDGSYVGRTGPNCEFAPCPE |
| A0A1F6ECB1 | 75-138 | None |
| A0A2M7R5X4 | 1-65 | None |
| A0A1J5FJJ3 | 47-114 | None |
| A0A7T9I199 | 2-76 | None |
| A0A521WKD0 | 4-75 | None |
| A0A1G2L8L9 | 13-81 | None |
| A0A6M8VWY1 | 2-65 | None |
| A0A352R5D1 | 5-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.