DPCstruct | MC6705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 157 ± 30 aa |
| Standard deviation of domain lengths | 29.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16872 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6GQC3 | 30-157 | YSKRGIFDELKETDIYDTKQKLFSGNQHLLGHYFRHLFQTVKYIDQQKWWVLSQKEKYEYIKTLRAQMSNYEQALFFINSLTQLGRK… |
| A0A2A5PHJ1 | 15-171 | SQILDISYVIFYFGIEGSWTTFIVNKLSRYNGFNEELVIKIQKRLMEKDFRGCLLKTNQTHLSSYFRNMYNAIKIVDESKILSDFEK… |
| A0A2R7KFR3 | 1-149 | None |
| A0A1I6VXX4 | 18-251 | None |
| A0A7X6E7B8 | 38-198 | None |
| A0A3D9ESF3 | 163-364 | None |
| A0A344LRV9 | 272-404 | None |
| A0A1H4GUH4 | 154-359 | None |
| A0A1I1ZSU0 | 21-161 | None |
| A0A4V2FSA5 | 274-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.