DPCstruct | MC6704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 373 |
|---|---|
| Mean domain length (aa) | 187 ± 34 aa |
| Standard deviation of domain lengths | 34.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 97.36 |
| Assigned Pfam label(s) | CL0039- CL0229- CL0108- PF11566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R0HQV2 | 7-210 | QRCCLSDPAHPHALRRQDNPRPSECFSCGPLGGSDDNWNDWHYYCDICKLVFHEGCEIFPLRLRHPYHPTHLLYTTLRFSETNILSF… |
| A0A1R2AVV2 | 279-482 | TCAVCKGTGNCEVWHCSLCFYSICKKCGTSRGVNAVEMSNSCIKGHTLNLVNDKNKTCSQCQTSIKDKHYSCGICPYIICKKCYRFA… |
| A0A6P4B3P1 | 56-261 | None |
| A0A445DA78 | 381-598 | None |
| A0A3P6C2I6 | 92-261 | None |
| A0A5B6WJE8 | 691-960 | None |
| A0A5B6VVH6 | 431-664 | None |
| A0A5N6PJF8 | 1-144 | None |
| A0A1U7YBI1 | 98-312 | None |
| A0A1U8PM86 | 23-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.