DPCstruct | MC6703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 194 ± 30 aa |
| Standard deviation of domain lengths | 30.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.77 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0404- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q1DXE5 | 7-176 | DIPGLAVGHHSMDSTGVTVIRVTDGDGALAAVDVRGGGPGTRETDLLDPHNTVERVHAITLAGGSAFGLAAADGVMRGLAQQKVGFP… |
| A0A1N7MEB5 | 1-217 | MSKKRLREYGYSVGRLPTGVHNSITDVAQVQVGHTTLNKPSQGILTGVTAILPHDGNPFQEKVAAAVHVINGFGKTTGLIQVEELGV… |
| A0A399Z277 | 4-200 | None |
| A0A0A2WCK5 | 24-236 | None |
| A0A8B0KT55 | 2-185 | None |
| A0A810Q5Y5 | 38-237 | None |
| A0A817CIT4 | 147-372 | None |
| R5FRT7 | 100-307 | None |
| A0A2U3E2Y8 | 162-397 | None |
| A0A815VZD3 | 18-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.