DPCstruct | MC6700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 17.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6BE43 | 107-205 | REIIEVDASPLTVESFIVDNAKRVAAKPFDFQVTFEPDEGHYMAEGQFNMLVSGETREELADALSDTLRLLWTEYVASDASDFTEDA… |
| H5SET8 | 37-137 | LEIVSERAHTKQTWVRDLHRDDLEVLSPIPITIEEFDDEVVATWPEVEVYASAETESEAIAKLKQEIVQLFEELRETPDKELGKLPR… |
| A0A849QF38 | 75-180 | None |
| A0A7Y4SVK3 | 101-192 | None |
| A0A127B9Z8 | 251-346 | None |
| A0A1V4V0U4 | 187-274 | None |
| A0A139X836 | 17-122 | None |
| A0A063ZCL9 | 39-134 | None |
| A0A1M3CYW6 | 203-304 | None |
| A0A431HR41 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.