DPCstruct | MC67
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 146 ± 30 aa |
| Standard deviation of domain lengths | 29.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9RIN0 | 3-154 | IVYLDQNKWIELARAVKSPNDFPAYYAVLQSLVTEANAGRLLVPLTSTNLYETQKIAIPERREHLAWVQSTLSQGMVFRGRHKRLEV… |
| A0A1G6SGF2 | 80-210 | LRGRPTIYLDQNHWSTLANAIYDPGRVHSAAELEAARELIELAKAKRVVLPVSAGHMQETCQDGIDERRYQRALTMLQISVGWRLTD… |
| A0A660L977 | 212-313 | None |
| A0A1H8NGX5 | 71-180 | None |
| N1TZ62 | 32-181 | None |
| A0A0F0G0D5 | 2-102 | None |
| A0A1H9CUD5 | 7-207 | None |
| G7H2I1 | 2-128 | None |
| A0A1V5DD10 | 86-198 | None |
| A0A117S0E8 | 38-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.