DPCstruct | MC6698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18085 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540R548 | 4-116 | ATVHPEAALSPTKDELCAELSAITERLGSYRAVDPDGEVGIEVIIGRTFSGELGQLFLSYRAADNATKKEIARMDHSVLGERSVAFG… |
| A0A7J5DZJ9 | 1-110 | MAIIHRATLSPSKPELLAAWLGGEVEVLGSFRYDDPAGEVGVEAFVVRVGGEVRHVPLAYRGAPATYDGAVPVGTMEHSVLGARWVY… |
| A0A1C5JZH6 | 95-228 | None |
| A0A7J9X509 | 1-121 | None |
| A0A239CAL5 | 1-127 | None |
| A0A0K2QY04 | 1-108 | None |
| A0A1G9UHC7 | 1-106 | None |
| A0A1I1HD79 | 1-111 | None |
| A0A1G7ISE8 | 110-225 | None |
| A0A1R4FK86 | 31-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.