DPCstruct | MC6697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 265 ± 19 aa |
| Standard deviation of domain lengths | 19.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6H3F0 | 1-258 | MTEPWGVQVSYCTGVARRVLLRITVAHLLRTFFNSPDEHIDEFERQLRESSRSVQAIHSWIKGLPQKSGQQILGIIRTILNTLKPTG… |
| A0A2J6T470 | 3-269 | SDLHGVEVSPCTHNTQRVSLAYLLGLDCMASLLSGFSWKSEQYKNEHFETLKDHSRELRQLNSEFREQFEQAVMLCLKMLSKTGVDR… |
| A0A179FQF4 | 834-1055 | None |
| A0A2V1BGV1 | 97-389 | None |
| A0A124GT15 | 591-856 | None |
| A0A2J6PF31 | 725-1008 | None |
| A0A428UZ36 | 336-583 | None |
| A0A0J5PT74 | 673-927 | None |
| A0A3M2TFK9 | 210-494 | None |
| A0A166X7N3 | 912-1169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.