DPCstruct | MC6696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8NJ70 | 1-110 | MSAQGSFQGAGQAFQGFFIAEDRQILASGSFNPPLVQYGAPNLTLAYGNLAELSGNYQVDPGPSYVGPTDVNITAEDDNGNTVSLHG… |
| A0A5N6GU87 | 132-242 | MPTSQGVFNGNFNQFEGHWVVDGIRVQLRGNFSQSVGQFQSIDATLEYDSTEDLVGPYVIDTAQQPSHVGNTDVALSLVRGDGKKVK… |
| A0A545V775 | 110-213 | None |
| A0A2D3HHT6 | 5-132 | None |
| A0A0K6G262 | 127-247 | None |
| A0A511GS41 | 5-110 | None |
| B0T5S3 | 14-146 | None |
| A0A832NLA2 | 12-130 | None |
| A0A3D3GDU2 | 36-186 | None |
| A0A2V7HVA1 | 2-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.