DPCstruct | MC6694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 18.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U1LJS1 | 451-548 | HQSGTLRNFTALRQLNIGVKCLFGMALGISAQHSVNTKLADLLPPHLERLCIRGYIPGNNQFYDTHIQDLFQKFVAGQLPGLTEVIG… |
| A0A5N6GG99 | 1-137 | MDSKESNDAYTVGEDPFEKDYIEGRPTSLRDFTIMKDLTISVKLPVALICASIGNSGSEDPSWSLVDILASNLEYPYILGYTFGASS… |
| A0A3D8SIS5 | 367-476 | None |
| A0A842YWR7 | 427-518 | None |
| A0A1Q5UL81 | 1-104 | None |
| A0A0K8L0A3 | 74-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.