DPCstruct | MC6692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 155 ± 26 aa |
| Standard deviation of domain lengths | 26.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11991 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2SUA0 | 20-155 | DFIDFPNHEQKLWWHSTAPMFAEMLRVAGYDLHSQYKILGIFLNHVIPFLGVYPTRINNRWLSILTRYGTPFELSLNCSQSLVRYTY… |
| A0A3M7K4Z5 | 1-171 | MHIPCPLSPTNFEALTEELEFSNENWKQWCYKTGPILLKLMTSSVYSIERQHQYLEFYVRVIIACLGPYPQVVRSSLTQSGLPVEFS… |
| A0A4Q2DVB8 | 48-221 | None |
| Q5AT98 | 28-177 | None |
| Q5BAT5 | 19-168 | None |
| A0A317V723 | 13-214 | None |
| C4JZR2 | 1-179 | None |
| A0A2H4SQ07 | 2-112 | None |
| L7JEU3 | 5-132 | None |
| A0A178F5C7 | 20-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.