DPCstruct | MC6691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023BTB1 | 4-126 | IAISAQPEDNHEDRRALRKEFYESLSESQKKELENKRELRKEQRKTMHASFTKEQLAIIENEDLSRKGKRKALKLTLSESQKEMHKN… |
| A0A2N2X932 | 24-144 | QQNQNRGKNMNKAAVETMTAEQKQLIQEQRDRIKEKRELFRASLTEAQLAIFDNNDLTRQERHDALMNSLTETQKALMQEHRESIQE… |
| A0A2E5RK50 | 1-131 | None |
| A0A5B7TT68 | 17-153 | None |
| A0A553GAB6 | 110-221 | None |
| A0A5R9QNB1 | 117-242 | None |
| A0A099Y6I3 | 1-124 | None |
| A0A2K9PRF5 | 1-124 | None |
| A0A2T5BX29 | 37-157 | None |
| A0A5J4J1F7 | 6-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.