DPCstruct | MC6689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 182 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5DL70 | 11-183 | LSGFSLIGLLAYLAVAVLALATGALARRFVRPADQVRGWILLAVWFVCLAAYRGFAVEDAAKALVRGRFRESGVYADRWYVQAPTIL… |
| A0A1N6CPJ6 | 6-177 | NSTQAAGLLAFLIAFGCCLIPGRRGAWSWLAAIYLALAIEMMVETRHGLRLLVNDVMQRGGLYADRTGYQLAIAGLLTILVLAVLYQ… |
| A0A0H0XRR3 | 2-169 | None |
| A0A2W4NE33 | 11-201 | None |
| Y0KFJ9 | 26-201 | None |
| A0A6G9W5N3 | 14-192 | None |
| A0A258QYG2 | 94-264 | None |
| A0A848UD08 | 3-184 | None |
| A0A419RUP0 | 22-204 | None |
| A0A1U7CKU4 | 3-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.