DPCstruct | MC6688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 7.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.63 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | PF06331- PF10471- CL0247 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4L5P3 | 1-55 | MRAIRGVLFTCDSAVKQILLTMNEKQSFIIEDLDDYHVMVKADEEYRVRKELEAE |
| C4YC80 | 30-92 | MPTASKGVLVRCDPSIRALILQIDSTRRGIVLQELDNNHLMIKQDMVQFVKDELNRLLSKNIY |
| T5BRD3 | 2-58 | None |
| A0A397SIL2 | 2-73 | None |
| L7J2Y4 | 1-66 | None |
| A0A6V7Q0C5 | 490-565 | None |
| A0A0E0H8G2 | 45-112 | None |
| A0A7R8H9Y8 | 28-97 | None |
| A0A834LV90 | 13-80 | None |
| A0A4U5MIQ9 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.