DPCstruct | MC6685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 578 ± 105 aa |
| Standard deviation of domain lengths | 104.90 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.66 |
| Pfam Score | 84.42 |
| Assigned Pfam label(s) | CL0111- PF08711- PF16192- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1W0R0 | 1-506 | MTGLSIGCVCSVKLVGLFVTALVGLYTIEDLWNKFGDTKMPVTTLGAHVVTRVVGLIIVPFLVYMLSFALHFAILDQTGPGDAQMSS… |
| C4XZJ9 | 54-653 | GVSSKDLLLIAALVLSSALLRLRGLEKPNSVVFDEVHFGGFSQKYILGTFFMDVHPPLAKMLFAWVASIGGFKGDFDFASIGDIYPE… |
| A0A1C7N4L6 | 18-699 | None |
| B4DSA5 | 23-567 | None |
| A0A821B8V7 | 19-436 | None |
| A0A6A6B482 | 11-485 | None |
| A0A0S7KDE3 | 2-482 | None |
| A0A284RU99 | 362-1042 | None |
| A0A098VU30 | 10-451 | None |
| A0A7J7KFR2 | 68-752 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.