DPCstruct | MC6684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 555 ± 51 aa |
| Standard deviation of domain lengths | 51.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4XYH2 | 12-558 | KKSTTIQRSPDEVYPQRKGLNKPQYLGNSPLDQLFARLERLLSQNLQDITLESLHTSLLPGNPIREHNAAIYDVAKQLLDLLAEVQA… |
| A0A180GNY2 | 21-543 | GDDRRTQAAAQGNPHIHQSKKKKKKQQQQQQQQQQQQQQQQQQQQQQEDEIRKRTNELLRAAGKPETQPPTIELLATLNQLIRHKHP… |
| A0A0B7FTF1 | 14-600 | None |
| A0A0L6V4R5 | 2-417 | None |
| Q54Y11 | 90-637 | None |
| A0A090XDZ8 | 2-574 | None |
| A0A167CHW3 | 22-601 | None |
| A0A0J8RAL1 | 17-626 | None |
| A0A821VQZ9 | 5-541 | None |
| A0A6P3ELR2 | 52-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.