DPCstruct | MC6683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 205 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7LT26 | 4-206 | KEVNTIDIAQLGAEIGMEAKEQTLPNGKVVKSLVWDQENLLKAVNAVKHLSEEGKSVRITGAAPAWLVSALTHTVHPCPVGVYMPQI… |
| A0A7J2WQ86 | 5-207 | FKLSGDRVQLLEFTIKKEVLEPSDLLLMRPPSVDPSKPLIMSGRGPHWLYQFLVHNYHFCRILATFEPRIGRGVIVESPSPREIGMS… |
| A0A1G1LPA9 | 127-336 | None |
| A0A3M0WX59 | 27-233 | None |
| A0A2H0PIS2 | 158-360 | None |
| A0A3D0Z1E8 | 2-189 | None |
| A0A7V5CIY7 | 19-223 | None |
| A0A0P6XSB9 | 196-375 | None |
| A0A2H0KBW0 | 242-447 | None |
| K9VVH3 | 3-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.