DPCstruct | MC6681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 169 ± 23 aa |
| Standard deviation of domain lengths | 22.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1BEG1 | 9-159 | KYLFFEVRIDRYGVLVNGSSSKIMIDFPMYVVEDSTLRVMGSLELNSSVILLLGGLHSISGDMGGGVSSNVYPVLSLPYIFEDVEIL… |
| A0A7J2JRU6 | 24-174 | RVEGRYLLLESWTYVRGEALEGGPRELMIDFPTYRLDEESGVLVSYRPLSLNSSVKLIVGEGTSLSGDVGSGVSSQIVGIYNLPADL… |
| A0A847NYI8 | 317-469 | None |
| A0A1L5LI80 | 1-229 | None |
| A0A0G2ZCD3 | 8-193 | None |
| A0A6I5BJN6 | 2-132 | None |
| A0A6M6EAW1 | 5-188 | None |
| A0A4Y6V136 | 1-196 | None |
| A0A532V853 | 176-351 | None |
| A0A3N1CZ37 | 2-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.