DPCstruct | MC668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 18.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 58.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9DUB4 | 19-149 | IEVYRSDGKLAVYSDLADAHGLLKLGGSDFHGKGGHGESPLGSVSLPVLAVHDFLSIARPIWCDAINNILEQYIKEPSELNLQHITR… |
| A0A453IS96 | 1-122 | AGFSQLAEKYGLLKLGGSDFHGKGTKDETDVGEVKLAITTLCSFLEMARPIWCSAMKDILLKFAEEPSAANLGKTLKFGQLSNPDGF… |
| A0A6A2YI88 | 70-175 | None |
| A0A7J8T1Q0 | 317-496 | None |
| A0A5D2WFD6 | 1-149 | None |
| A0A2N9GT81 | 182-321 | None |
| A0A2G3B9D0 | 454-609 | None |
| A0A7J7M2P7 | 689-838 | None |
| A0A067DTH3 | 294-430 | None |
| A0A067DGC9 | 109-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.